PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G133800.1.p
Common NameLOC101779362, SETIT_001941mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 367aa    MW: 38549.3 Da    PI: 9.246
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G133800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.42.4e-11110154347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+ E+  ++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
  Seita.5G133800.1.p 110 PWTEGEHRMFLMGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 154
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.1E-4222IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.001103159IPR017930Myb domain
SuperFamilySSF466891.64E-15105160IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-18106158IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-10107153IPR009057Homeodomain-like
SMARTSM007172.2E-9107157IPR001005SANT/Myb domain
PfamPF002495.4E-9110154IPR001005SANT/Myb domain
CDDcd001672.78E-7110155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPA RSGGGGGGGG VRLFGVRLTT APAPAAMKKS ASMSCIASSL  60
GGGSGGSSPP AGGDAGGRGG GDGGAGYVSD DPAHASCSTN GRAERKKGTP WTEGEHRMFL  120
MGLQKLGKGD WRGISRNFVV SRTPTQVASH AQKYFIRQSN SSRRKRRSSL FDMVPEMPMD  180
ESPAAVEQFT LQNTQDEAAS SNQLPALHLG QQKKVEVAKQ LPTFQLSQHE ESEYAEPSLP  240
LPDLEMNSGA PFKTISVPAV PAFYPTLVPV PLTLWPPSVA HVEESGTTHE VLKPTPLNGK  300
EAVKADDVVG MSKLSIGEAS SVSMEPTALS LQLIGSTDAR QSAFHVSPPM NRPELSKRNS  360
SPIHAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0382700.0BT038270.1 Zea mays full-length cDNA clone ZM_BFb0221P08 mRNA, complete cds.
GenBankEU9652590.0EU965259.1 Zea mays clone 284869 myb-related transcription activator mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660652.10.0PREDICTED: uncharacterized protein LOC101779362
TrEMBLK3XJ680.0K3XJ68_SETIT; Uncharacterized protein
STRINGSi001941m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19393791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-58MYB_related family protein